PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013620259.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 381aa    MW: 41856.8 Da    PI: 8.0153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013620259.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-154387146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g W+ eEd  l ++v+++G+++W++ ar ++ gR++k+c++rw +
   XP_013620259.1 43 KGTWSREEDVMLSELVEKFGPRNWSSMARSIP-GRSGKSCRLRWGN 87
                     799*****************************.***********55 PP

2Myb_DNA-binding51.32.7e-1695137145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r+++T+ Ede ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w+
   XP_013620259.1  95 RNPFTEVEDEAIITAHAIHGNK-WSIIAKLLP-GRTDNAIKNHWN 137
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6973889IPR017930Myb domain
SuperFamilySSF466891.8E-2941136IPR009057Homeodomain-like
SMARTSM007172.6E-144291IPR001005SANT/Myb domain
PfamPF002495.6E-154387IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-224496IPR009057Homeodomain-like
CDDcd001675.03E-134587No hitNo description
PROSITE profilePS5129425.78790144IPR017930Myb domain
SMARTSM007174.2E-1694142IPR001005SANT/Myb domain
PfamPF002494.1E-1495137IPR001005SANT/Myb domain
CDDcd001676.84E-1297140No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2297143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEGEMWRRSG IGEMAVAGGR RDDGVAMFVG EGTSGRRRKK RIKGTWSREE DVMLSELVEK  60
FGPRNWSSMA RSIPGRSGKS CRLRWGNQLD PSLKRNPFTE VEDEAIITAH AIHGNKWSII  120
AKLLPGRTDN AIKNHWNATL RRRCTDFETP TTNTPTGNLL LQDSRLDRTM NTFASSEETL  180
SSGGGGGGGG HVTTPIVSSD GKEATSMNIS EEQPSDKANE EDISRQVCND PPTLFRPVAK  240
LSSFNPYNHM EGSSTPHTLN QNKFQSCKQD TAMLRLVEGA YSERFVPQKC GSGCCSVSQK  300
DSLLGPEFVD YLDPPTFPSY ELAAIATDIS SLAWLRSGLE SSSVRAMEEA AGRLRPQGTR  360
GHRDHCLVSE QGKSRTNVLS T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-364214457159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-364214457159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-36421433104C-Myb DNA-Binding Domain
1msf_C2e-36421433104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13540RRRKKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747500.0KF974750.1 Brassica napus MYB transcription factor 1 (MYB1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620259.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A0D3AEY50.0A0A0D3AEY5_BRAOL; Uncharacterized protein
STRINGBra034057.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-173myb domain protein 1